Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eed Peptide - C-terminal region

Eed Peptide - C-terminal region

Product Specifications

Product Name Alternative

Afx, Afxh, Mllt7

UniProt

Q9WVH3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eed Rabbit Polyclonal Antibody (orb329981) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061259

Preservative

Lyophilized powder

AA Sequence

LEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CO2 Incubator Air Jacketed BCAJ-6802
BCAJ-6802 1 Unit

CO2 Incubator Air Jacketed BCAJ-6802

Sign In for Pricing
View Details
Xlr Mouse Gene Knockout Kit (CRISPR)
KN519498 1 Kit

Xlr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: transverse
CS631815 5x 5 µm

Frozen Tissue Sections, Colon: transverse

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), Biotin conjugate, 0.1mg/mL
BNCB1869-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lymph node
CS621282 5x 5 µm

Frozen Tissue Sections, Lymph node

Sign In for Pricing
View Details
Neurotensin Receptor 1 (NTSR1) Human Gene Knockout Kit (CRISPR)
KN220548LP 1 Kit

Neurotensin Receptor 1 (NTSR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details