Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eed Peptide - C-terminal region

Eed Peptide - C-terminal region

Product Specifications

Product Name Alternative

Afx, Afxh, Mllt7

UniProt

Q9WVH3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eed Rabbit Polyclonal Antibody (orb329981) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061259

Preservative

Lyophilized powder

AA Sequence

LEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Selenok (NM_019979) Mouse Tagged ORF Clone
MG200234 10 µg

Selenok (NM_019979) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Hoechst 33342 alkyne
17673-AAT 1 mg

Hoechst 33342 alkyne

Sign In for Pricing
View Details
25-Desacetyl Rifapentin
TRC-D288720-5MG 5 mg

25-Desacetyl Rifapentin

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (ID8), 1mg/mL
BNUM0920-50 1x 50 µL

Myosin, Smooth Muscle Heavy Chain (ID8), 1mg/mL

Sign In for Pricing
View Details
Cdk2ap2 (NM_026373) Mouse Tagged ORF Clone
MG200685 10 µg

Cdk2ap2 (NM_026373) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Colloidal Gold Conjugated Lens culinaris Lectin (Lentil) -LcH-,  15nm
GP-1401-15 1 mL

Colloidal Gold Conjugated Lens culinaris Lectin (Lentil) -LcH-, 15nm

Sign In for Pricing
View Details