Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1D Peptide - C-terminal region

EEF1D Peptide - C-terminal region

Product Specifications

Product Name Alternative

EF-1D, EF1D, FLJ20897, FP1047

UniProt

P29692

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EEF1D Rabbit Polyclonal Antibody (orb585292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001951

Preservative

Lyophilized powder

AA Sequence

FGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVAKSSILLDVKPWDDET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL19P10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1921306 1.0 µg DNA

RPL19P10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
WEE1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-23526R-BF750-01 20 µL

WEE1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
WEE1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-23526R-BF750-02 100 µL

WEE1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Kallikrein 8 Antibody
orb1318711 100 µL

Kallikrein 8 Antibody

Sign In for Pricing
View Details
Recombinant Azoarcus sp. PKHD-type hydroxylase azo0608 (azo0608)
MBS1027825-01 0.02 mg (E-Coli)

Recombinant Azoarcus sp. PKHD-type hydroxylase azo0608 (azo0608)

Sign In for Pricing
View Details
Recombinant Azoarcus sp. PKHD-type hydroxylase azo0608 (azo0608)
MBS1027825-02 0.1 mg (E-Coli)

Recombinant Azoarcus sp. PKHD-type hydroxylase azo0608 (azo0608)

Sign In for Pricing
View Details