Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1D Peptide - C-terminal region

EEF1D Peptide - C-terminal region

Product Specifications

Product Name Alternative

EF-1D, EF1D, FLJ20897, FP1047

UniProt

P29692

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EEF1D Rabbit Polyclonal Antibody (orb585292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001951

Preservative

Lyophilized powder

AA Sequence

FGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVAKSSILLDVKPWDDET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Commd1 Pre-designed siRNA Set B
SI102917B 1 Each

Mouse Commd1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
PGC-1β (h) -PR
sc-62783-PR 10 µM - 20 µL

PGC-1β (h) -PR

Sign In for Pricing
View Details
Chicken Polyclonal Chicken anti-Mouse IgG (H+L) Secondary Antibody [Allophycocyanin/Cy7]
NBP1-75098APCCY7 0.5 mL

Chicken Polyclonal Chicken anti-Mouse IgG (H+L) Secondary Antibody [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
CCDC43 (h) : 293T Lysate
sc-116138 100 µg - 200 µL

CCDC43 (h) : 293T Lysate

Sign In for Pricing
View Details
Troponin Complex, Cardiac (TnC, TnI, TnT, TNNC1, TNNT2, TNNI3) (APC) discontinued
T8665-11B-APC 100 µL

Troponin Complex, Cardiac (TnC, TnI, TnT, TNNC1, TNNT2, TNNI3) (APC) discontinued

Sign In for Pricing
View Details
Pefloxacin PEF 5 µg
9091/1 50 Discs

Pefloxacin PEF 5 µg

Sign In for Pricing
View Details