Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFCAB3 Peptide - N-terminal region

EFCAB3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ25818, MGC126801, MGC126827

UniProt

Q8N7B9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EFCAB3 Rabbit Polyclonal Antibody (orb582007) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775774

Preservative

Lyophilized powder

AA Sequence

MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (((4-Bromophenyl) sulfonyl) amino) benzamide
FB169101-01 10 g

2- (((4-Bromophenyl) sulfonyl) amino) benzamide

Sign In for Pricing
View Details
2- (((4-Bromophenyl) sulfonyl) amino) benzamide
FB169101-02 25 g

2- (((4-Bromophenyl) sulfonyl) amino) benzamide

Sign In for Pricing
View Details
ZCWPW2 shRNA Plasmid (h)
sc-78129-SH 20 µg

ZCWPW2 shRNA Plasmid (h)

Sign In for Pricing
View Details
Goat Anti-Atrial natriuretic factor, Biotinylated Antibody
MBS428920-01 0.1 mg

Goat Anti-Atrial natriuretic factor, Biotinylated Antibody

Sign In for Pricing
View Details
Goat Anti-Atrial natriuretic factor, Biotinylated Antibody
MBS428920-02 5x 0.1 mg

Goat Anti-Atrial natriuretic factor, Biotinylated Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Cdc23 Antibody [DyLight 680]
NBP1-77156FR 0.1 mL

Rabbit Polyclonal Cdc23 Antibody [DyLight 680]

Sign In for Pricing
View Details