Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFCAB3 Peptide - N-terminal region

EFCAB3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ25818, MGC126801, MGC126827

UniProt

Q8N7B9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EFCAB3 Rabbit Polyclonal Antibody (orb582007) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775774

Preservative

Lyophilized powder

AA Sequence

MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lincomycin HCl
S2479-50mg 50 mg

Lincomycin HCl

Sign In for Pricing
View Details
PTMA CRISPRa sgRNA lentivector (set of three targets)(Mouse)
38114124 3x 1.0µg DNA

PTMA CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Pirh2 (E-11) : m-IgG1 BP-HRP Bundle
sc-545219 1 Kit

Pirh2 (E-11) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Anti-Human CENPN Antibody, Carrier-free
DZ41626-carrier-free 200 µL/Vial

Anti-Human CENPN Antibody, Carrier-free

Sign In for Pricing
View Details
YIPF2 Human shRNA Plasmid Kit (Locus ID 78992)
TL300413 1 Kit

YIPF2 Human shRNA Plasmid Kit (Locus ID 78992)

Sign In for Pricing
View Details
VIL1 (Villin 1, VIL, D2S1471) discontinued
214132-01 20 µL

VIL1 (Villin 1, VIL, D2S1471) discontinued

Sign In for Pricing
View Details