Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNA4 Peptide - N-terminal region

EFNA4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EFL4, EPLG4, LERK4, MGC125826

UniProt

P52798

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EFNA4 Rabbit Polyclonal Antibody (orb585063) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872632

Preservative

Lyophilized powder

AA Sequence

GPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBX2 (Gastrulation Brain Homeobox 2) (MaxLight 650)
246507-ML650 100 µL

GBX2 (Gastrulation Brain Homeobox 2) (MaxLight 650)

Sign In for Pricing
View Details
PCTP antibody - middle region
MBS3216347-01 0.1 mL

PCTP antibody - middle region

Sign In for Pricing
View Details
PCTP antibody - middle region
MBS3216347-02 5x 0.1 mL

PCTP antibody - middle region

Sign In for Pricing
View Details
KRT26, NT (KRT26, KRT25B, Keratin, type I cytoskeletal 26, Cytokeratin-26, Keratin-25B, Keratin-26, Type I inner root sheath-specific keratin-K25irs2) (Biotin) discontinued
037611-Biotin 200 µL

KRT26, NT (KRT26, KRT25B, Keratin, type I cytoskeletal 26, Cytokeratin-26, Keratin-25B, Keratin-26, Type I inner root sheath-specific keratin-K25irs2) (Biotin) discontinued

Sign In for Pricing
View Details
RNF149 Lentiviral Activation Particles (h2)
sc-406588-LAC-2 200 µL

RNF149 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Acss3 Mouse qPCR Primer Pair (NM_001142804)
MP220330 200 Reactions

Acss3 Mouse qPCR Primer Pair (NM_001142804)

Sign In for Pricing
View Details