Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EG546729 Peptide - C-terminal region

EG546729 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EG546729

UniProt

D3Z291

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EG546729 Rabbit Polyclonal Antibody (orb325144) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074740

Preservative

Lyophilized powder

AA Sequence

GITDQGTMNRLLTSWHKCKPPLRLGQEAPLMSNGWAGGEPRPPRKEVATY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotinylated Anti-JAM-A antibody (DMC278) ; IgG1 Chimeric mAb
12-9221B-100 100 µg

Biotinylated Anti-JAM-A antibody (DMC278) ; IgG1 Chimeric mAb

Sign In for Pricing
View Details
Cystatin B (CSTB, CST6, PME, Stefin B, STFB)
C8949-20B 100 µL

Cystatin B (CSTB, CST6, PME, Stefin B, STFB)

Sign In for Pricing
View Details
USP22 Antibody, HRP conjugated
CSB-PA891982LB01HU-01 50 µg

USP22 Antibody, HRP conjugated

Sign In for Pricing
View Details
USP22 Antibody, HRP conjugated
CSB-PA891982LB01HU-02 100 µg

USP22 Antibody, HRP conjugated

Sign In for Pricing
View Details
RPLP0 cDNA Clone
MBS1277862-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

RPLP0 cDNA Clone

Sign In for Pricing
View Details
RPLP0 cDNA Clone
MBS1277862-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

RPLP0 cDNA Clone

Sign In for Pricing
View Details