Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ehf Peptide - middle region

Ehf Peptide - middle region

Product Specifications

Product Name Alternative

9030625L19Rik, AU019492

UniProt

O70273

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ehf Rabbit Polyclonal Antibody (orb576119) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_031940

Preservative

Lyophilized powder

AA Sequence

LFQSAHNVIVKTEQTDPSIMNTWKEENYLYDPSYGSTVDLLDSKTFCRAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CTGF protein
orb1292414-01 50 µg

Mouse CTGF protein

Sign In for Pricing
View Details
Mouse CTGF protein
orb1292414-02 100 µg

Mouse CTGF protein

Sign In for Pricing
View Details
Mouse CTGF protein
orb1292414-03 200 µg

Mouse CTGF protein

Sign In for Pricing
View Details
Mouse CTGF protein
orb1292414-04 1 mg

Mouse CTGF protein

Sign In for Pricing
View Details
CFTR ELISA Kit (Human) (OKCD08127)
OKCD08127 96 Well

CFTR ELISA Kit (Human) (OKCD08127)

Sign In for Pricing
View Details
ELISA Kit For DNA mismatch repair protein Mlh1
E15452r 96 Tests

ELISA Kit For DNA mismatch repair protein Mlh1

Sign In for Pricing
View Details