Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2AK2 Peptide - middle region

EIF2AK2 Peptide - middle region

Product Specifications

Product Name Alternative

EIF2AK1, MGC126524, PKR, PRKR

UniProt

P19525

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF2AK2 Rabbit Polyclonal Antibody (orb576081) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002750

Preservative

Lyophilized powder

AA Sequence

QVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TMLHE Antibody, Rabbit Polyclonal
MBS8107828-01 0.1 mL

Anti-TMLHE Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-TMLHE Antibody, Rabbit Polyclonal
MBS8107828-02 5x 0.1 mL

Anti-TMLHE Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Goat Apoptosis Signal Regulating Kinase 1 (ASK1) ELISA Kit
MBS268332-01 48 Well

Goat Apoptosis Signal Regulating Kinase 1 (ASK1) ELISA Kit

Sign In for Pricing
View Details
Goat Apoptosis Signal Regulating Kinase 1 (ASK1) ELISA Kit
MBS268332-02 96 Well

Goat Apoptosis Signal Regulating Kinase 1 (ASK1) ELISA Kit

Sign In for Pricing
View Details
Goat Apoptosis Signal Regulating Kinase 1 (ASK1) ELISA Kit
MBS268332-03 5x 96 Well

Goat Apoptosis Signal Regulating Kinase 1 (ASK1) ELISA Kit

Sign In for Pricing
View Details
Goat Apoptosis Signal Regulating Kinase 1 (ASK1) ELISA Kit
MBS268332-04 10x 96 Well

Goat Apoptosis Signal Regulating Kinase 1 (ASK1) ELISA Kit

Sign In for Pricing
View Details