Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif2c3 Peptide - N-terminal region

Eif2c3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW048688, Ago3, C130014L07Rik, Eif2c3

UniProt

Q8CJF9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eif2c3 Rabbit Polyclonal Antibody (orb584123) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_700451

Preservative

Lyophilized powder

AA Sequence

VHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALG11 antibody
70R-6417 100 µL

ALG11 antibody

Sign In for Pricing
View Details
Porcine Macrophage Inflammatory Protein 3 Beta (MIP3b) ELISA Kit
RD-MIP3b-p-01 96 Tests

Porcine Macrophage Inflammatory Protein 3 Beta (MIP3b) ELISA Kit

Sign In for Pricing
View Details
Porcine Macrophage Inflammatory Protein 3 Beta (MIP3b) ELISA Kit
RD-MIP3b-p-02 48 Tests

Porcine Macrophage Inflammatory Protein 3 Beta (MIP3b) ELISA Kit

Sign In for Pricing
View Details
Human LCE1C knockout cell line
ABC-KH8321 1 Vial

Human LCE1C knockout cell line

Sign In for Pricing
View Details
DL-Lysine
abx185976-01 10 g

DL-Lysine

Sign In for Pricing
View Details
DL-Lysine
abx185976-02 100 g

DL-Lysine

Sign In for Pricing
View Details