Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif2c3 Peptide - N-terminal region

Eif2c3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW048688, Ago3, C130014L07Rik, Eif2c3

UniProt

Q8CJF9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eif2c3 Rabbit Polyclonal Antibody (orb584123) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_700451

Preservative

Lyophilized powder

AA Sequence

VHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal CD6 Antibody (96123) [PE/Cy5.5]
FAB727PECY55 0.5 mL

Rat Monoclonal CD6 Antibody (96123) [PE/Cy5.5]

Sign In for Pricing
View Details
Anti-SOCS4 Antibody Picoband® Fluoro488 Conjugated
PB9506-Fluoro488 100 µg/Vial

Anti-SOCS4 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Anti-Trop2 (tizetatug biosimilar) mAb
MBS1881798-01 0.05 mg

Anti-Trop2 (tizetatug biosimilar) mAb

Sign In for Pricing
View Details
Anti-Trop2 (tizetatug biosimilar) mAb
MBS1881798-02 0.1 mg

Anti-Trop2 (tizetatug biosimilar) mAb

Sign In for Pricing
View Details
Anti-Trop2 (tizetatug biosimilar) mAb
MBS1881798-03 5x 0.1 mg

Anti-Trop2 (tizetatug biosimilar) mAb

Sign In for Pricing
View Details
JQKD82
T39989-01 25 mg

JQKD82

Sign In for Pricing
View Details