Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3F Peptide - N-terminal region

EIF3F Peptide - N-terminal region

Product Specifications

Product Name Alternative

EIF3S5, eIF3-p47

UniProt

O00303

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF3F Rabbit Polyclonal Antibody (orb585179) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003745

Preservative

Lyophilized powder

AA Sequence

VILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SCLY Protein, His Tag
E40KMPH5121 20 µg

Human SCLY Protein, His Tag

Sign In for Pricing
View Details
Uteroglobin (SCGB1A1) Human Recombinant Protein
TP727746 10 µg

Uteroglobin (SCGB1A1) Human Recombinant Protein

Sign In for Pricing
View Details
COX5B (NM_001862) Human Over-expression Lysate
LY419690 100 µg

COX5B (NM_001862) Human Over-expression Lysate

Sign In for Pricing
View Details
THRSP Rabbit pAb
A7232-01 20 µL

THRSP Rabbit pAb

Sign In for Pricing
View Details
THRSP Rabbit pAb
A7232-02 100 μL

THRSP Rabbit pAb

Sign In for Pricing
View Details
THRSP Rabbit pAb
A7232-03 500 μL

THRSP Rabbit pAb

Sign In for Pricing
View Details