Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3F Peptide - N-terminal region

EIF3F Peptide - N-terminal region

Product Specifications

Product Name Alternative

EIF3S5, eIF3-p47

UniProt

O00303

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF3F Rabbit Polyclonal Antibody (orb585179) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003745

Preservative

Lyophilized powder

AA Sequence

VILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pig Blood vessel epicardial substance (BVES), partial
MBS7054169 Inquire

Recombinant Pig Blood vessel epicardial substance (BVES), partial

Sign In for Pricing
View Details
Pbx3 Rabbit Monoclonal Antibody
E56G0693 100 µL

Pbx3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)
MBS2056331-01 0.1 mL

APC-Linked Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)
MBS2056331-02 0.2 mL

APC-Linked Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)
MBS2056331-03 0.5 mL

APC-Linked Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)
MBS2056331-04 1 mL

APC-Linked Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)

Sign In for Pricing
View Details