Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3K Peptide - C-terminal region

EIF3K Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARG134, EIF3-p28, EIF3S12, HSPC029, M9, MSTP001, PLAC-24, PLAC24, PRO1474, PTD001

UniProt

Q9UBQ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF3K Rabbit Polyclonal Antibody (orb331174) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037366

Preservative

Lyophilized powder

AA Sequence

AEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nibrin (Nijmegen Breakage Syndrome, NBS1) (FITC)
N2498-04-FITC 100 µL

Nibrin (Nijmegen Breakage Syndrome, NBS1) (FITC)

Sign In for Pricing
View Details
CD5L (CD5 Antigen-like, CD5 Molecule-like, AIM, API6, CT-2, IgM-associated Peptide, PRO229, SPalpha, SP-alpha) (PE)
MBS6467950-01 0.1 mL

CD5L (CD5 Antigen-like, CD5 Molecule-like, AIM, API6, CT-2, IgM-associated Peptide, PRO229, SPalpha, SP-alpha) (PE)

Sign In for Pricing
View Details
CD5L (CD5 Antigen-like, CD5 Molecule-like, AIM, API6, CT-2, IgM-associated Peptide, PRO229, SPalpha, SP-alpha) (PE)
MBS6467950-02 5x 0.1 mL

CD5L (CD5 Antigen-like, CD5 Molecule-like, AIM, API6, CT-2, IgM-associated Peptide, PRO229, SPalpha, SP-alpha) (PE)

Sign In for Pricing
View Details
Recombinant Human FABP6
Pr22128-01 10 µg

Recombinant Human FABP6

Sign In for Pricing
View Details
Recombinant Human FABP6
Pr22128-02 50 µg

Recombinant Human FABP6

Sign In for Pricing
View Details
Recombinant Human FABP6
Pr22128-03 500 µg

Recombinant Human FABP6

Sign In for Pricing
View Details