Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif4e Peptide - C-terminal region

Eif4e Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC93265

UniProt

P63074

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eif4e Rabbit Polyclonal Antibody (orb584152) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446426

Preservative

Lyophilized powder

AA Sequence

TTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFV

More Discoveries

Explore Other Products

Browse additional items from our catalog

pExpress-1-FBXO25 Plasmid
PVT35548 2 µg

pExpress-1-FBXO25 Plasmid

Sign In for Pricing
View Details
Myc Antibody (Thr358)
MBS5313486-01 0.1 mg

Myc Antibody (Thr358)

Sign In for Pricing
View Details
Myc Antibody (Thr358)
MBS5313486-02 5x 0.1 mg

Myc Antibody (Thr358)

Sign In for Pricing
View Details
Recombinant Human Igg2 Fc (223AA)
FY-PN53287 50 µg

Recombinant Human Igg2 Fc (223AA)

Sign In for Pricing
View Details
Prss52 ORF Vector (Mouse) (pORF)
37867014 1.0 µg DNA

Prss52 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Clostridium Phytofermentans mnmE Protein (aa 1-458)
VAng-Lsx01360-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Phytofermentans mnmE Protein (aa 1-458)

Sign In for Pricing
View Details