Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif4e Peptide - C-terminal region

Eif4e Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC93265

UniProt

P63074

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eif4e Rabbit Polyclonal Antibody (orb584152) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446426

Preservative

Lyophilized powder

AA Sequence

TTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scrib (BC060689) Mouse Tagged ORF Clone Lentiviral Particle
MR211217L3V 200 µL

Scrib (BC060689) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TRBV2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2449708 1.0 µg DNA

TRBV2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
EHBP1 Polyclonal Antibody
A66510-100 100 µL

EHBP1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal RNF8 Antibody [Alexa Fluor 700]
NBP1-77166AF700 0.1 mL

Rabbit Polyclonal RNF8 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
IFluor® 430 Anti-human CD120a Antibody *H398*
11200030-AAT 100 Tests

IFluor® 430 Anti-human CD120a Antibody *H398*

Sign In for Pricing
View Details
RPL26L1
333112-01 50 µL

RPL26L1

Sign In for Pricing
View Details