EIF4E2 Peptide - N-terminal region
EIF4E2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
4E-LP, 4EHP, EIF4EL3, IF4e
UniProt
O60573
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EIF4E2 Rabbit Polyclonal Antibody (orb584153) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004837
Preservative
Lyophilized powder
AA Sequence
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
V2110-18F-HRP 100 µL
VEGFR-2 (Vascular Endothelial Growth Factor Receptor 2, VEGFR-2, FLK-1, KDR) (VEGFR2, VEGFR 2, Protein-tyrosine kinase receptor flk-1, Fetal liver kinase 1, Kinase NYK, FLK1, KDR, Kinase insert domain receptor, KRD1, Ly73, Protein tyrosine kinase receptor FLK1, Vascular endothelial growth factor receptor 2) (HRP)
Sign In for Pricing
View Details 
GTR15287509 1 Vial
Lentiviral mouse Tbc1d12 shRNA (UAS) - Lentiviral mouse Tbc1d12 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details 