Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4E2 Peptide - N-terminal region

EIF4E2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4E-LP, 4EHP, EIF4EL3, IF4e

UniProt

O60573

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF4E2 Rabbit Polyclonal Antibody (orb584153) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004837

Preservative

Lyophilized powder

AA Sequence

MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (Dimethyl-1H-1,2,4-triazol-1-yl) butanoic acid
ZZB38028-01 50 mg

4- (Dimethyl-1H-1,2,4-triazol-1-yl) butanoic acid

Sign In for Pricing
View Details
4- (Dimethyl-1H-1,2,4-triazol-1-yl) butanoic acid
ZZB38028-02 0.5 g

4- (Dimethyl-1H-1,2,4-triazol-1-yl) butanoic acid

Sign In for Pricing
View Details
PAPPA Rabbit pAb, PerCP-Cy7 conjugated
orb2846296 100 µL

PAPPA Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
ANP32B Mouse Monoclonal
MBS766679-01 0.1 mg

ANP32B Mouse Monoclonal

Sign In for Pricing
View Details
ANP32B Mouse Monoclonal
MBS766679-02 5x 0.1 mg

ANP32B Mouse Monoclonal

Sign In for Pricing
View Details
Human TSR1 Protein Lysate
MBS8429243-01 0.02 mg

Human TSR1 Protein Lysate

Sign In for Pricing
View Details