Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4E2 Peptide - N-terminal region

EIF4E2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4E-LP, 4EHP, EIF4EL3, IF4e

UniProt

O60573

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF4E2 Rabbit Polyclonal Antibody (orb584154) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004837

Preservative

Lyophilized powder

AA Sequence

YTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTG

More Discoveries

Explore Other Products

Browse additional items from our catalog

AB-680 ammonium
T73886-01 5 mg

AB-680 ammonium

Sign In for Pricing
View Details
AB-680 ammonium
T73886-02 50 mg

AB-680 ammonium

Sign In for Pricing
View Details
Galectin 2 (LGALS2) Antibody
abx116855 100 µL

Galectin 2 (LGALS2) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Caspase-7 Antibody (7-1-11) [DyLight 594]
NBP1-19229DL594 0.1 mL

Mouse Monoclonal Caspase-7 Antibody (7-1-11) [DyLight 594]

Sign In for Pricing
View Details
Goat COL3a1 ELISA Kit
EGTC0331 96 Tests

Goat COL3a1 ELISA Kit

Sign In for Pricing
View Details
DHDH (2DD, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase, D-xylose 1-dehydrogenase, D-xylose-NADP Dehydrogenase, Dimeric Dihydrodiol Dehydrogenase, Hum2DD) (FITC)
125813-FITC 100 µL

DHDH (2DD, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase, D-xylose 1-dehydrogenase, D-xylose-NADP Dehydrogenase, Dimeric Dihydrodiol Dehydrogenase, Hum2DD) (FITC)

Sign In for Pricing
View Details