EIF4E2 Peptide - N-terminal region
EIF4E2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
4E-LP, 4EHP, EIF4EL3, IF4e
UniProt
O60573
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EIF4E2 Rabbit Polyclonal Antibody (orb584154) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004837
Preservative
Lyophilized powder
AA Sequence
YTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTG
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8804649-01 48 Well
Rat TARC (Thymus Activation Regulated Chemokine) ELISA Kit
Sign In for Pricing
View Details 
MBS8804649-02 96 Well
Rat TARC (Thymus Activation Regulated Chemokine) ELISA Kit
Sign In for Pricing
View Details MBS8804649-03 5x 96 Well
Rat TARC (Thymus Activation Regulated Chemokine) ELISA Kit
Sign In for Pricing
View Details MBS8804649-04 10x 96 Well
Rat TARC (Thymus Activation Regulated Chemokine) ELISA Kit
Sign In for Pricing
View Details 
ARP47542_P050-HRP 100 µL
NOBOX Antibody - middle region : HRP (ARP47542_P050-HRP)
Sign In for Pricing
View Details MBS2048830-01 0.1 mL
FITC-Linked Polyclonal Antibody to Epithelial Neutrophil Activating Peptide 78 (ENA78)
Sign In for Pricing
View Details