Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif4ebp1 Peptide - N-terminal region

Eif4ebp1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4e-bp1, AA959816, PHAS-I

UniProt

Q60876

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eif4ebp1 Rabbit Polyclonal Antibody (orb581543) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031944

Preservative

Lyophilized powder

AA Sequence

ALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TP53BP2 Polyclonal Antibody
E-AB-14774-01 20 µL

TP53BP2 Polyclonal Antibody

Sign In for Pricing
View Details
TP53BP2 Polyclonal Antibody
E-AB-14774-02 60 µL

TP53BP2 Polyclonal Antibody

Sign In for Pricing
View Details
TP53BP2 Polyclonal Antibody
E-AB-14774-03 120 µL

TP53BP2 Polyclonal Antibody

Sign In for Pricing
View Details
TP53BP2 Polyclonal Antibody
E-AB-14774-04 200 µL

TP53BP2 Polyclonal Antibody

Sign In for Pricing
View Details
Human SSX7 activation kit by CRISPRa
GA116959 1 Kit

Human SSX7 activation kit by CRISPRa

Sign In for Pricing
View Details
Human TXN activation kit by CRISPRa
GA105025 1 Kit

Human TXN activation kit by CRISPRa

Sign In for Pricing
View Details