Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif4ebp1 Peptide - N-terminal region

Eif4ebp1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4e-bp1, AA959816, PHAS-I

UniProt

Q60876

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eif4ebp1 Rabbit Polyclonal Antibody (orb581543) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031944

Preservative

Lyophilized powder

AA Sequence

ALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Cst3 Protein (Trx Tag)
PDEM100128-01 20 µg

Recombinant Mouse Cst3 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse Cst3 Protein (Trx Tag)
PDEM100128-02 100 µg

Recombinant Mouse Cst3 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse Cst3 Protein (Trx Tag)
PDEM100128-03 500 µg

Recombinant Mouse Cst3 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse Cst3 Protein (Trx Tag)
PDEM100128-04 1 mg

Recombinant Mouse Cst3 Protein (Trx Tag)

Sign In for Pricing
View Details
EED Antibody
KC-1066-01 50 μL

EED Antibody

Sign In for Pricing
View Details
EED Antibody
KC-1066-02 100 µL

EED Antibody

Sign In for Pricing
View Details