Eif4ebp2 Peptide - N-terminal region
Eif4ebp2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
2810011I19Rik, 4E-BP2, AA792569, BC010348, MGC141219, PHAS-II
UniProt
P70445
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Eif4ebp2 Rabbit Polyclonal Antibody (orb581544) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_034254
Preservative
Lyophilized powder
AA Sequence
GSHQPSQSRAIPTRTVAISDAAQLPQDYCTTPGGTLFSTTPGGTRIIYDR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15224174 1 Vial
Lentiviral mouse Rcc1 shRNA (UAS) - Lentiviral mouse Rcc1 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details MBS2121970-01 0.1 mL
Cy3-Linked Polyclonal Antibody to Cloprostenol (CP)
Sign In for Pricing
View Details MBS2121970-02 0.2 mL
Cy3-Linked Polyclonal Antibody to Cloprostenol (CP)
Sign In for Pricing
View Details MBS2121970-03 0.5 mL
Cy3-Linked Polyclonal Antibody to Cloprostenol (CP)
Sign In for Pricing
View Details MBS2121970-04 1 mL
Cy3-Linked Polyclonal Antibody to Cloprostenol (CP)
Sign In for Pricing
View Details