Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF6 Peptide - N-terminal region

EIF6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2, CAB, EIF3A, ITGB4BP, b, b (2) gcn, gcn, p27BBP, eIF-6, p27 (BBP)

UniProt

P56537

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF6 Rabbit Polyclonal Antibody (orb585008) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002203

Preservative

Lyophilized powder

AA Sequence

AVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMPCB CRISPR Activation Plasmid (h2)
sc-405207-ACT-2 20 µg

PMPCB CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
PIK3R6 CRISPR Knock Out 293T Cell Line (Human)
36690141 1x 10^6 Cells / 1.0 mL

PIK3R6 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Mouse SEPP1 (Selenoprotein P1, Plasma) ELISA Kit
EM22991 96 Tests

Mouse SEPP1 (Selenoprotein P1, Plasma) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody [Alexa Fluor 647]
NBP2-99216AF647 0.1 mL

Rabbit Polyclonal Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Recombinant Human GRAP2 protein
MBS1562010-01 0.05 mg

Recombinant Human GRAP2 protein

Sign In for Pricing
View Details
Recombinant Human GRAP2 protein
MBS1562010-02 0.1 mg

Recombinant Human GRAP2 protein

Sign In for Pricing
View Details