Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF6 Peptide - N-terminal region

EIF6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2, CAB, EIF3A, ITGB4BP, b, b (2) gcn, gcn, p27BBP, eIF-6, p27 (BBP)

UniProt

P56537

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF6 Rabbit Polyclonal Antibody (orb585008) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002203

Preservative

Lyophilized powder

AA Sequence

AVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Smo/Smoothened homolog ELISA Kit
E0921Ra 96 Tests

Rat Smo/Smoothened homolog ELISA Kit

Sign In for Pricing
View Details
RIC8A Polyclonal Antibody, Cy3 Conjugated
bs-11355R-Cy3 100 µL

RIC8A Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Human Heparan sulfate 6 O sulfotransferase 1 (HS6ST1) ELISA Kit
MBS7251506-01 48 Well

Human Heparan sulfate 6 O sulfotransferase 1 (HS6ST1) ELISA Kit

Sign In for Pricing
View Details
Human Heparan sulfate 6 O sulfotransferase 1 (HS6ST1) ELISA Kit
MBS7251506-02 96 Well

Human Heparan sulfate 6 O sulfotransferase 1 (HS6ST1) ELISA Kit

Sign In for Pricing
View Details
Human Heparan sulfate 6 O sulfotransferase 1 (HS6ST1) ELISA Kit
MBS7251506-03 5x 96 Well

Human Heparan sulfate 6 O sulfotransferase 1 (HS6ST1) ELISA Kit

Sign In for Pricing
View Details
Human Heparan sulfate 6 O sulfotransferase 1 (HS6ST1) ELISA Kit
MBS7251506-04 10x 96 Well

Human Heparan sulfate 6 O sulfotransferase 1 (HS6ST1) ELISA Kit

Sign In for Pricing
View Details