Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ela1 Peptide - middle region

Ela1 Peptide - middle region

Product Specifications

Product Name Alternative

1810009A17Rik, 1810062B19Rik, Ela-1, Ela1, PC-TsF

UniProt

Q91X79

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ela1 Rabbit Polyclonal Antibody (orb325713) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_291090

Preservative

Lyophilized powder

AA Sequence

RVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAGYDIALLRLAKSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FBXW7 (-/-) HCT116 Cell Line
ABC-KD5439 1 Vial

Human FBXW7 (-/-) HCT116 Cell Line

Sign In for Pricing
View Details
Human EMR1 (EGF Like Module Containing Mucin Like Hormone Receptor 1) ELISA Kit
EH25873 96 Tests

Human EMR1 (EGF Like Module Containing Mucin Like Hormone Receptor 1) ELISA Kit

Sign In for Pricing
View Details
ABCB8 siRNA (Mouse)
orb1839981-01 15 nmol

ABCB8 siRNA (Mouse)

Sign In for Pricing
View Details
ABCB8 siRNA (Mouse)
orb1839981-02 30 nmol

ABCB8 siRNA (Mouse)

Sign In for Pricing
View Details
NPM Antibody
ABF6111 100 µg

NPM Antibody

Sign In for Pricing
View Details
BEND7 Protein Vector (Human) (pPM-C-HA)
13288021 500 ng

BEND7 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details