Ela1 Peptide - middle region
Ela1 Peptide - middle region
Product Specifications
Product Name Alternative
1810009A17Rik, 1810062B19Rik, Ela-1, Ela1, PC-TsF
UniProt
Q91X79
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ela1 Rabbit Polyclonal Antibody (orb325713) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_291090
Preservative
Lyophilized powder
AA Sequence
RVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAGYDIALLRLAKSV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
351529-01 50 µg
TK2, Recombinant, Human, aa34-265, His-Tag (Thymidine Kinase 2, Mitochondrial, MTDPS2, MTTK)
Sign In for Pricing
View Details 351529-02 250 µg
TK2, Recombinant, Human, aa34-265, His-Tag (Thymidine Kinase 2, Mitochondrial, MTDPS2, MTTK)
Sign In for Pricing
View Details ARP34872_P050-Biotin 100 µL
TRIM35 Antibody - C-terminal region : Biotin (ARP34872_P050-Biotin)
Sign In for Pricing
View Details 