Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELAVL2 Peptide - N-terminal region

ELAVL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HEL-N1, HELN1, HUB

UniProt

Q12926

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELAVL2 Rabbit Polyclonal Antibody (orb577633) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004423

Preservative

Lyophilized powder

AA Sequence

METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNLIVNYLPQNM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aurora B (Proliferation Marker) (AURKB/1592), CF488A conjugate, 0.1mg/mL
BNC881592-500 1x 500 µL

Aurora B (Proliferation Marker) (AURKB/1592), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Accuris High Fidelity DNA Polymerase, sample, 20 units
PR1000-HF-S 1 Each

Accuris High Fidelity DNA Polymerase, sample, 20 units

Sign In for Pricing
View Details
Recombinant Human IFI30 Protein (His Tag)
PKSH030801 100 µg

Recombinant Human IFI30 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse DDR1 Kinase/MCK10 Protein (His Tag)
PKSM040462 100 µg

Recombinant Mouse DDR1 Kinase/MCK10 Protein (His Tag)

Sign In for Pricing
View Details
CD176 / T-F Ag (Thomsen-Friedenreich Ag) (A68-B/A11), 0.2mg/mL
BNUB0937-100 1x 100 µL

CD176 / T-F Ag (Thomsen-Friedenreich Ag) (A68-B/A11), 0.2mg/mL

Sign In for Pricing
View Details
NR2E1 (NM_001286102) Human Tagged ORF Clone
RG238134 10 µg

NR2E1 (NM_001286102) Human Tagged ORF Clone

Sign In for Pricing
View Details