Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Elf4 Peptide - N-terminal region

Elf4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AV314029, BC042423, ENSMUSG00000053512, Gm9907, MGC129343, MGC129361, Mef

UniProt

B1AY67

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Elf4 Rabbit Polyclonal Antibody (orb576258) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062654

Preservative

Lyophilized powder

AA Sequence

DDLKKTSDAGDQKEHSEEEKVSREENLRKMGKARKRNRKTKNNRSTSPVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (1-24) (Human, Rat, Mouse, Porcine) - I-125 Labeled
T-001-06 10 µCi

ACTH (1-24) (Human, Rat, Mouse, Porcine) - I-125 Labeled

Sign In for Pricing
View Details
PFKFB1 (NM_001271805) Human Tagged ORF Clone
RG234007 10 µg

PFKFB1 (NM_001271805) Human Tagged ORF Clone

Sign In for Pricing
View Details
Poglut1 AAV siRNA Pooled Vector
37141166 1.0 µg

Poglut1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
anti-PD-L1 VHH antibody (Alexa Fluor® 647)
JOT0002-5-4-50 50

anti-PD-L1 VHH antibody (Alexa Fluor® 647)

Sign In for Pricing
View Details
Human Dual oxidase maturation factor 1 (DUOXA1) ELISA Kit
abx510843 96 Tests

Human Dual oxidase maturation factor 1 (DUOXA1) ELISA Kit

Sign In for Pricing
View Details
TranScriba Kit
4000-20 20 Reactions in 20 μL

TranScriba Kit

Sign In for Pricing
View Details