Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Elf4 Peptide - N-terminal region

Elf4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AV314029, BC042423, ENSMUSG00000053512, Gm9907, MGC129343, MGC129361, Mef

UniProt

B1AY67

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Elf4 Rabbit Polyclonal Antibody (orb576258) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062654

Preservative

Lyophilized powder

AA Sequence

DDLKKTSDAGDQKEHSEEEKVSREENLRKMGKARKRNRKTKNNRSTSPVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPRED1 (NM_152594) Human Tagged ORF Clone Lentiviral Particle
RC220714L1V 200 µL

SPRED1 (NM_152594) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PANC-1 (NFkB) Luciferase Reporter Cell Line
ABC-RC509H 1 Vial

PANC-1 (NFkB) Luciferase Reporter Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal SPINK2 Antibody [CoraFluor 1]
NBP2-82015CL1 0.1 mL

Rabbit Polyclonal SPINK2 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
MAP1LC3A Rabbit pAb, Pacific Blue conjugated
orb2867342 100 µL

MAP1LC3A Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
KRT10 Antibody, HRP conjugated
A27150-100UG 100 µg

KRT10 Antibody, HRP conjugated

Sign In for Pricing
View Details
Mouse Chitinase 3 Like Protein 2 ELISA Kit
MBS101152-01 48 Well

Mouse Chitinase 3 Like Protein 2 ELISA Kit

Sign In for Pricing
View Details