Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELMOD1 Peptide - middle region

ELMOD1 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp547C176

UniProt

Q8N336

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELMOD1 Rabbit Polyclonal Antibody (orb583509) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001123509

Preservative

Lyophilized powder

AA Sequence

CYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF20 Recombinant Antibody, APC Conjugated
bsm-61100R-APC-01 20 µL

RNF20 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
RNF20 Recombinant Antibody, APC Conjugated
bsm-61100R-APC-02 100 µL

RNF20 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Topors shRNA (UAS) - Lentiviral mouse Topors shRNA (UAS, RFP) plasmid
GTR15122257 1 Vial

Lentiviral mouse Topors shRNA (UAS) - Lentiviral mouse Topors shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Human Polymorphonuclear Elastase (PMN Elastase) ELISA Kit
GA-E0868HM-01 48 Tests

Human Polymorphonuclear Elastase (PMN Elastase) ELISA Kit

Sign In for Pricing
View Details
Human Polymorphonuclear Elastase (PMN Elastase) ELISA Kit
GA-E0868HM-02 96 Tests

Human Polymorphonuclear Elastase (PMN Elastase) ELISA Kit

Sign In for Pricing
View Details
Clint1 (NM_001002022) Rat Tagged Lenti ORF Clone
RR212338L3 10 µg

Clint1 (NM_001002022) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details