Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELMOD3 Peptide - C-terminal region

ELMOD3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ21977, FLJ35601, LST3, MGC111036, RBED1, RBM29

UniProt

Q96FG2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELMOD3 Rabbit Polyclonal Antibody (orb55712) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115589

Preservative

Lyophilized powder

AA Sequence

FRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRECNRQQKVIPVVNSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kctd1 (NM_134112) Mouse Tagged ORF Clone Lentiviral Particle
MR215954L4V 200 µL

Kctd1 (NM_134112) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human AFDN Protein
E30P10843 20 µg

Recombinant Human AFDN Protein

Sign In for Pricing
View Details
FGF22 Antibody
ASA-B0702 1 Each

FGF22 Antibody

Sign In for Pricing
View Details
ZNF837 Human Gene Knockout Kit (CRISPR)
KN425912 1 Kit

ZNF837 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CREB3 siRNA (Human)
CRH7125-01 15 nmol

CREB3 siRNA (Human)

Sign In for Pricing
View Details
CREB3 siRNA (Human)
CRH7125-02 30 nmol

CREB3 siRNA (Human)

Sign In for Pricing
View Details