Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELMOD3 Peptide - C-terminal region

ELMOD3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ21977, FLJ35601, LST3, MGC111036, RBED1, RBM29

UniProt

Q96FG2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELMOD3 Rabbit Polyclonal Antibody (orb55712) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115589

Preservative

Lyophilized powder

AA Sequence

FRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRECNRQQKVIPVVNSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duck Phosphoinositide-3-Kinase Class-2-Alpha Polypeptide ELISA Kit
MBS103581 Inquire

Duck Phosphoinositide-3-Kinase Class-2-Alpha Polypeptide ELISA Kit

Sign In for Pricing
View Details
Urotensin-2 (UTS2) Rat ELISA Kit
I1620 96 Tests

Urotensin-2 (UTS2) Rat ELISA Kit

Sign In for Pricing
View Details
Crk-L Rabbit mAb
E60M0827 100 µL

Crk-L Rabbit mAb

Sign In for Pricing
View Details
GPR44 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-13537R-BF350 100 µL

GPR44 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
GALR3 Antibody
R35279-100UG 100 µg

GALR3 Antibody

Sign In for Pricing
View Details
4-Aminophenyl b-D-mannopyranoside HCl
MA05305-01 25 mg

4-Aminophenyl b-D-mannopyranoside HCl

Sign In for Pricing
View Details