Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOF1 Peptide - N-terminal region

ELOF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ELF1

UniProt

P60002

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELOF1 Rabbit Polyclonal Antibody (orb584679) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115753

Preservative

Lyophilized powder

AA Sequence

RKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nectin 3 (NECTIN3) Human Gene Knockout Kit (CRISPR)
KN222962BN 1 Kit

Nectin 3 (NECTIN3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAM107A (NM_007177) Human Recombinant Protein
TP319825L 1 mg

FAM107A (NM_007177) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Seminal vesicle
CS800676 5x 5 µm

Tissue FFPE Sections, Seminal vesicle

Sign In for Pricing
View Details
Monosulfuron
TRC-M567185-25MG 25 mg

Monosulfuron

Sign In for Pricing
View Details
RBM5 Polyclonal Antibody
E-AB-15336-01 20 µL

RBM5 Polyclonal Antibody

Sign In for Pricing
View Details
RBM5 Polyclonal Antibody
E-AB-15336-02 60 µL

RBM5 Polyclonal Antibody

Sign In for Pricing
View Details