Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOF1 Peptide - N-terminal region

ELOF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ELF1

UniProt

P60002

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELOF1 Rabbit Polyclonal Antibody (orb584679) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115753

Preservative

Lyophilized powder

AA Sequence

RKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc12a5 Mouse Monoclonal Antibody [Clone ID: N1/12]
75-013 100 µL

Slc12a5 Mouse Monoclonal Antibody [Clone ID: N1/12]

Sign In for Pricing
View Details
SNAP25 Antibody
8C0326-AAT 50 µg

SNAP25 Antibody

Sign In for Pricing
View Details
ERCC1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H5]
TA501140BM 100 µL

ERCC1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H5]

Sign In for Pricing
View Details
PCCB Rabbit Polyclonal Antibody
TA366707 100 µL

PCCB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ribostamycin Sulfate
TRC-R417700-50MG 50 mg

Ribostamycin Sulfate

Sign In for Pricing
View Details
N,N-Bis(2-chloroethyl)benzenesulfonamide-d5
TRC-B418912-2.5MG 2.5 mg

N,N-Bis(2-chloroethyl)benzenesulfonamide-d5

Sign In for Pricing
View Details