Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOF1 Peptide - middle region

ELOF1 Peptide - middle region

Product Specifications

Product Name Alternative

ELF1

UniProt

P60002

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELOF1 Rabbit Polyclonal Antibody (orb584680) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115753

Preservative

Lyophilized powder

AA Sequence

SCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3017), CF594 conjugate, 0.1mg/mL
BNC943017-100 1x 100 µL

TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3017), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KCNN4 (NM_002250) Human Over-expression Lysate
LC400818 20 µg

KCNN4 (NM_002250) Human Over-expression Lysate

Sign In for Pricing
View Details
CROCCP3 Antibody
KC-3703-01 50 μL

CROCCP3 Antibody

Sign In for Pricing
View Details
CROCCP3 Antibody
KC-3703-02 100 µL

CROCCP3 Antibody

Sign In for Pricing
View Details
CROCCP3 Antibody
KC-3703-03 1 mL

CROCCP3 Antibody

Sign In for Pricing
View Details
Cnfn Mouse Gene Knockout Kit (CRISPR)
KN503537 1 Kit

Cnfn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details