Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Elp4 Peptide - middle region

Elp4 Peptide - middle region

Product Specifications

Product Name Alternative

A330107A17Rik, Paxneb

UniProt

Q9ER73

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Elp4 Rabbit Polyclonal Antibody (orb576279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076365

Preservative

Lyophilized powder

AA Sequence

FMAEGIINGHTLLVASAKENPAKILQELPAPLLDDNSKKELEDVHSAKTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C1QL4 activation kit by CRISPRa
GA117389 1 Kit

Human C1QL4 activation kit by CRISPRa

Sign In for Pricing
View Details
Myeloid-Associated Differentiation Marker (MYADM/971), CF740 conjugate, 0.1mg/mL
BNC740971-100 1x 100 µL

Myeloid-Associated Differentiation Marker (MYADM/971), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lbh (NM_029999) Mouse Tagged ORF Clone
MG200356 10 µg

Lbh (NM_029999) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS706865 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
TentaGel® MB HMBA
MB160140.50G 50 g

TentaGel® MB HMBA

Sign In for Pricing
View Details
Lipoprotein lipase (LPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G8]
TA503790BM 100 µL

Lipoprotein lipase (LPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G8]

Sign In for Pricing
View Details