Elp4 Peptide - middle region
Elp4 Peptide - middle region
Product Specifications
Product Name Alternative
A330107A17Rik, Paxneb
UniProt
Q9ER73
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Elp4 Rabbit Polyclonal Antibody (orb576279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_076365
Preservative
Lyophilized powder
AA Sequence
FMAEGIINGHTLLVASAKENPAKILQELPAPLLDDNSKKELEDVHSAKTP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GM-202-20 1 mL
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG2 GOM1, 20nm
Sign In for Pricing
View Details ![CD3D Recombinant Rabbit Monoclonal Antibody [JJ08-97]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81d9d/imageurl/et1701-57.webp)
ET1701-57 100 µL
CD3D Recombinant Rabbit Monoclonal Antibody [JJ08-97]
Sign In for Pricing
View Details 
LY420908 100 µg
Calpastatin (CAST) (NM_001042444) Human Over-expression Lysate
Sign In for Pricing
View Details