Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EMD Peptide - N-terminal region

EMD Peptide - N-terminal region

Product Specifications

Product Name Alternative

EDMD, LEMD5, STA

UniProt

P50402

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EMD Rabbit Polyclonal Antibody (orb585525) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000108

Preservative

Lyophilized powder

AA Sequence

YEKKIFEYETQRRRLSPPSSSAASSYSFSDLNSTRGDADMYDLPKKEDAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KHDC3L Protein Lysate
MBS8413996-01 0.02 mg

Human KHDC3L Protein Lysate

Sign In for Pricing
View Details
Human KHDC3L Protein Lysate
MBS8413996-02 5x 0.02 mg

Human KHDC3L Protein Lysate

Sign In for Pricing
View Details
MPEG-N3 (MW 2000)
HY-W1049092-01 5 mg

MPEG-N3 (MW 2000)

Sign In for Pricing
View Details
MPEG-N3 (MW 2000)
HY-W1049092-02 10 mg

MPEG-N3 (MW 2000)

Sign In for Pricing
View Details
MPEG-N3 (MW 2000)
HY-W1049092-03 25 mg

MPEG-N3 (MW 2000)

Sign In for Pricing
View Details
MPEG-N3 (MW 2000)
HY-W1049092-04 50 mg

MPEG-N3 (MW 2000)

Sign In for Pricing
View Details