Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EMD Peptide - N-terminal region

EMD Peptide - N-terminal region

Product Specifications

Product Name Alternative

EDMD, LEMD5, STA

UniProt

P50402

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EMD Rabbit Polyclonal Antibody (orb585525) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000108

Preservative

Lyophilized powder

AA Sequence

YEKKIFEYETQRRRLSPPSSSAASSYSFSDLNSTRGDADMYDLPKKEDAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stk39 (NM_016866) Mouse Tagged ORF Clone Lentiviral Particle
MR208807L4V 200 µL

Stk39 (NM_016866) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral human CDK5 shRNA (UAS) - Lentiviral human CDK5 shRNA (UAS, RFP) plasmid
GTR15323752 1 Vial

Lentiviral human CDK5 shRNA (UAS) - Lentiviral human CDK5 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
ZNF818P Human qPCR Primer Pair (NM_001001675)
HP201012 200 Reactions

ZNF818P Human qPCR Primer Pair (NM_001001675)

Sign In for Pricing
View Details
P21 Activated Kinase 6 (PAK6) Antibody
abx048495-01 100 µg

P21 Activated Kinase 6 (PAK6) Antibody

Sign In for Pricing
View Details
P21 Activated Kinase 6 (PAK6) Antibody
abx048495-02 1 mg

P21 Activated Kinase 6 (PAK6) Antibody

Sign In for Pricing
View Details
Rpl12 (NM_009076) Mouse Tagged Lenti ORF Clone
MR201323L3 10 µg

Rpl12 (NM_009076) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details