Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRE2 Peptide - N-terminal region

ADGRE2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

VBU, CD97, EMR2, CD312

UniProt

Q9UHX3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADGRE2 Rabbit Polyclonal Antibody (orb585110) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_690883

Preservative

Lyophilized powder

AA Sequence

YDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH3A1 (NM_001135168) Human Over-expression Lysate
LC427570 20 µg

ALDH3A1 (NM_001135168) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Protein Lysate, Urinary bladder
CP565517 150 µg

Tissue Protein Lysate, Urinary bladder

Sign In for Pricing
View Details
(E)-Diethyl (2-Butenyl)phosphonate
TRC-D443828-5G 5 g

(E)-Diethyl (2-Butenyl)phosphonate

Sign In for Pricing
View Details
Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), Biotin conjugate, 0.1mg/mL
BNCB1981-100 1x 100 µL

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human TPO protein (His Tag)
PKSH034168-01 20 µg

Recombinant Human TPO protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human TPO protein (His Tag)
PKSH034168-02 100 µg

Recombinant Human TPO protein (His Tag)

Sign In for Pricing
View Details