Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRE2 Peptide - N-terminal region

ADGRE2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

VBU, CD97, EMR2, CD312

UniProt

Q9UHX3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADGRE2 Rabbit Polyclonal Antibody (orb585110) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_690883

Preservative

Lyophilized powder

AA Sequence

YDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79b (B-Cell Marker) (IGB/2940R), CF568 conjugate, 0.1mg/mL
BNC682940-100 1x 100 µL

CD79b (B-Cell Marker) (IGB/2940R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CF®660R Picolyl Azide
#96002 1x 500 µg

CF®660R Picolyl Azide

Sign In for Pricing
View Details
ARSB (NM_198709) Human Recombinant Protein
TP306565M 100 µg

ARSB (NM_198709) Human Recombinant Protein

Sign In for Pricing
View Details
Human CCDC172 activation kit by CRISPRa
GA117760 1 Kit

Human CCDC172 activation kit by CRISPRa

Sign In for Pricing
View Details
ERG (NM_182918) Human Over-expression Lysate
LC403650 20 µg

ERG (NM_182918) Human Over-expression Lysate

Sign In for Pricing
View Details
CD72 (B Cell Marker) (BU40), CF640R conjugate, 0.1mg/mL
BNC402906-500 1x 500 µL

CD72 (B Cell Marker) (BU40), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details