Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Endogl1 Peptide - N-terminal region

Endogl1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW557704, ENGL-B, ENGL-a, Endogl1, Endogl2, Engl, Engla, Englb

UniProt

Q8C163

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Endogl1 Rabbit Polyclonal Antibody (orb579817) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766044

Preservative

Lyophilized powder

AA Sequence

TETRRYTNHALSYDQAKRVPRWVLEHISKDKIIGDADRKHCKFKPDPSVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOG1 (RANGRF) CytoSection
TS412668P5 25 Slides

MOG1 (RANGRF) CytoSection

Sign In for Pricing
View Details
Treponema pallidum (Syphilis) (PE) discontinued
T8300-PE 100 µL

Treponema pallidum (Syphilis) (PE) discontinued

Sign In for Pricing
View Details
Mouse Homeobox protein Meis1, Meis1 ELISA KIT
ELI-08471m 96 Tests

Mouse Homeobox protein Meis1, Meis1 ELISA KIT

Sign In for Pricing
View Details
Thrombospondin 3 (THBS3) Antibody
abx431668 200 µL

Thrombospondin 3 (THBS3) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal CABP5 Antibody [mFluor Violet 500 SE]
NBP3-06122MFV500 0.1 mL

Rabbit Polyclonal CABP5 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Human CYB561 knockdown cell line
ABC-KD3816 1 Vial

Human CYB561 knockdown cell line

Sign In for Pricing
View Details