Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Endogl1 Peptide - N-terminal region

Endogl1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW557704, ENGL-B, ENGL-a, Endogl1, Endogl2, Engl, Engla, Englb

UniProt

Q8C163

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Endogl1 Rabbit Polyclonal Antibody (orb579817) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766044

Preservative

Lyophilized powder

AA Sequence

TETRRYTNHALSYDQAKRVPRWVLEHISKDKIIGDADRKHCKFKPDPSVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Golden star tunicate fuhc Antibody, HRP Conjugate
DZ41036-HRP 200 µL/Vial

Anti-Golden star tunicate fuhc Antibody, HRP Conjugate

Sign In for Pricing
View Details
Magnolan
TRC-M110380-5G 5 g

Magnolan

Sign In for Pricing
View Details
Olr214 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV630769 1.0 µg DNA

Olr214 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
MUC2 (Mucin 2) (MLP/2970R), CF568 conjugate, 0.1mg/mL
BNC682970-100 1x 100 µL

MUC2 (Mucin 2) (MLP/2970R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PPAT shRNA Plasmid
abx953671-01 150 µg

Human PPAT shRNA Plasmid

Sign In for Pricing
View Details
Human PPAT shRNA Plasmid
abx953671-02 300 µg

Human PPAT shRNA Plasmid

Sign In for Pricing
View Details