Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Endogl1 Peptide - N-terminal region

Endogl1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW557704, ENGL-B, ENGL-a, Endogl1, Endogl2, Engl, Engla, Englb

UniProt

Q8C163

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Endogl1 Rabbit Polyclonal Antibody (orb579817) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766044

Preservative

Lyophilized powder

AA Sequence

TETRRYTNHALSYDQAKRVPRWVLEHISKDKIIGDADRKHCKFKPDPSVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

V-ATPase C1 siRNA (m)
sc-36790 10 µM

V-ATPase C1 siRNA (m)

Sign In for Pricing
View Details
Rabbit Anti-Human PON1 pAb
PA6833-01 50 μL

Rabbit Anti-Human PON1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human PON1 pAb
PA6833-02 100 μL

Rabbit Anti-Human PON1 pAb

Sign In for Pricing
View Details
PNO40 Polyclonal Antibody
E20-73806 100 µg

PNO40 Polyclonal Antibody

Sign In for Pricing
View Details
CLEC4A (C-Type Lectin Domain Family 4, Member A, CLECSF6, DCIR, DDB27, HDCGC13P, LLIR)
244750 50 µL

CLEC4A (C-Type Lectin Domain Family 4, Member A, CLECSF6, DCIR, DDB27, HDCGC13P, LLIR)

Sign In for Pricing
View Details
PIC P028-Dia 050-PE-SHEET/2 Prohibited Activity Signs & Labels (Adhesive)
825570 2 Sheet (2 Panel (s) x 1 Sheet)

PIC P028-Dia 050-PE-SHEET/2 Prohibited Activity Signs & Labels (Adhesive)

Sign In for Pricing
View Details