Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENO2 Peptide - middle region

ENO2 Peptide - middle region

Product Specifications

Product Name Alternative

NSE

UniProt

P09104

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENO2 Rabbit Polyclonal Antibody (orb584794) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001966

Preservative

Lyophilized powder

AA Sequence

ESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse PDGFRa/CD140a Protein (Fc Tag)
PKSM041120-01 10 µg

Recombinant Mouse PDGFRa/CD140a Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse PDGFRa/CD140a Protein (Fc Tag)
PKSM041120-02 50 µg

Recombinant Mouse PDGFRa/CD140a Protein (Fc Tag)

Sign In for Pricing
View Details
N7-(2-Hydroxyethyl)guanine
TRC-H942200-50MG 50 mg

N7-(2-Hydroxyethyl)guanine

Sign In for Pricing
View Details
CD3e (B-B12), CF555 conjugate, 0.1mg/mL
BNC551052-100 1x 100 µL

CD3e (B-B12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Crystallin Alpha B (CRYaB) ELISA Kit
RDR-CRYaB-Hu-01 96 Tests

Human Crystallin Alpha B (CRYaB) ELISA Kit

Sign In for Pricing
View Details
Human Crystallin Alpha B (CRYaB) ELISA Kit
RDR-CRYaB-Hu-02 48 Tests

Human Crystallin Alpha B (CRYaB) ELISA Kit

Sign In for Pricing
View Details