Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENO2 Peptide - middle region

ENO2 Peptide - middle region

Product Specifications

Product Name Alternative

NSE

UniProt

P09104

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENO2 Rabbit Polyclonal Antibody (orb584794) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001966

Preservative

Lyophilized powder

AA Sequence

ESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS510601 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS709880 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
PTP kappa (PTPRK) (NM_001135648) Human Recombinant Protein
TP327943L 1 mg

PTP kappa (PTPRK) (NM_001135648) Human Recombinant Protein

Sign In for Pricing
View Details
Ep-CAM / CD326 (Cocktail PAN-EpCAM), Biotin conjugate, 0.1mg/mL
BNCB0969-500 1x 500 µL

Ep-CAM / CD326 (Cocktail PAN-EpCAM), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(R,R)-(-)-N,N'-Bis(3,5-ditert-butylsalicylidene)-1,2-cyclohexanediaminocobalt(II)
TRC-R287445-1G 1 g

(R,R)-(-)-N,N'-Bis(3,5-ditert-butylsalicylidene)-1,2-cyclohexanediaminocobalt(II)

Sign In for Pricing
View Details
DNAJC14 Rabbit Polyclonal Antibody
TA370163 100 µL

DNAJC14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details