Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENO2 Peptide - N-terminal region

ENO2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NSE

UniProt

P09104

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENO2 Rabbit Polyclonal Antibody (orb584795) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001966

Preservative

Lyophilized powder

AA Sequence

PALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNPEPL1 (NM_018226) Human Recombinant Protein
TP310266L 1 mg

RNPEPL1 (NM_018226) Human Recombinant Protein

Sign In for Pricing
View Details
Microwave Digester BMWD-106
BMWD-106 Each

Microwave Digester BMWD-106

Sign In for Pricing
View Details
Recombinant Human ANGPTL4 Protein (hIgG1 Fc Tag)
PDMH100444-01 20 µg

Recombinant Human ANGPTL4 Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Human ANGPTL4 Protein (hIgG1 Fc Tag)
PDMH100444-02 100 µg

Recombinant Human ANGPTL4 Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Human ANGPTL4 Protein (hIgG1 Fc Tag)
PDMH100444-03 500 µg

Recombinant Human ANGPTL4 Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Human ANGPTL4 Protein (hIgG1 Fc Tag)
PDMH100444-04 1 mg

Recombinant Human ANGPTL4 Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details