Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENO2 Peptide - N-terminal region

ENO2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NSE

UniProt

P09104

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENO2 Rabbit Polyclonal Antibody (orb584795) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001966

Preservative

Lyophilized powder

AA Sequence

PALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Adrenal gland
CS642836 5x 5 µm

Frozen Tissue Sections, Adrenal gland

Sign In for Pricing
View Details
Uncoated Human EGFR2 (Epidermal Growth Factor Receptor 2) ELISA Kit
E-UNEL-H0272-01 5x 96 Tests

Uncoated Human EGFR2 (Epidermal Growth Factor Receptor 2) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human EGFR2 (Epidermal Growth Factor Receptor 2) ELISA Kit
E-UNEL-H0272-02 15x 96 Tests

Uncoated Human EGFR2 (Epidermal Growth Factor Receptor 2) ELISA Kit

Sign In for Pricing
View Details
AP2B1 (Center) Rabbit Polyclonal Antibody
AP50201PU-N 400 µL

AP2B1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IL18BP Protein (Fc Tag)
PKSH032626-01 10 µg

Recombinant Human IL18BP Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL18BP Protein (Fc Tag)
PKSH032626-02 50 µg

Recombinant Human IL18BP Protein (Fc Tag)

Sign In for Pricing
View Details