Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENO2 Peptide - N-terminal region

ENO2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NSE

UniProt

P09104

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENO2 Rabbit Polyclonal Antibody (orb584795) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001966

Preservative

Lyophilized powder

AA Sequence

PALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Genomic DNA, Liver
CD563313 5 µg

Tissue Genomic DNA, Liver

Sign In for Pricing
View Details
CD95 / FAS / TNFRSF6 (FAS/3588), CF405S conjugate, 0.1mg/mL
BNC043588-500 1x 500 µL

CD95 / FAS / TNFRSF6 (FAS/3588), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ccdc28a (BC013553) Mouse Tagged ORF Clone
MG200865 10 µg

Ccdc28a (BC013553) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
OSGIN2 Mouse Monoclonal Antibody [Clone ID: OTI1C7]
CF808967 100 µg

OSGIN2 Mouse Monoclonal Antibody [Clone ID: OTI1C7]

Sign In for Pricing
View Details
MRPS7 Antibody
8C14044-AAT 50 µg

MRPS7 Antibody

Sign In for Pricing
View Details
UBE2E3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A3]
TA504680BM 100 µL

UBE2E3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A3]

Sign In for Pricing
View Details