ENOPH1 Peptide - N-terminal region
ENOPH1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DKFZp586M0524, E1, FLJ12594, MASA, MST145
UniProt
Q9UHY7
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ENOPH1 Rabbit Polyclonal Antibody (orb326212) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_067027
Preservative
Lyophilized powder
AA Sequence
IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880460-100 1x 100 µL
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682174-100 1x 100 µL
Cytokeratin 8 (KRT8) (KRT8/2174R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 